Recombinant Protein of Bovine MRPL52, aa 24-124(Cat#: RIJL-0225-JL454)
This product is a recombinant bovine MRPL52 protein with specific tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL52 protein with specific tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 13.8 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 24-124aa |
| Sequence | GSQWRLRQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAQREKFARRVVLLSQEMDAGLQAWQLRQQEKLQEEKRKQQNALKPKGVLLQNPGPSQ |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; Bioactivity Testing; Immunogen; ELISA; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRP-L52; Mitochondrial Large Ribosomal Subunit Protein ML52; Mitochondrial Ribosomal Protein L52; ML52; Large Ribosomal Subunit Protein ML52 |
| Gene ID | 509469 |
| UniProt ID | P0C2B7 |
| Location | Mitochondrion |
| Introduction | MRPL52 is a critical protein component of the mitochondrial large ribosomal subunit. Distributed exclusively within mitochondria, MRPL52 is pivotal for the synthesis of proteins essential to energy production and metabolic processes. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
