Recombinant Protein of Bovine MRPL27, aa 1-148(Cat#: RIJL-0225-JL420)
This product is a recombinant bovine MRPL27 protein with specific tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL27 protein with specific tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 16.0 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-148aa |
| Sequence | MALAVLAWRTRTAVIALLSPPQAAALAVRYASKKTGGSSKNLGGKSPGKRFGIRKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEEGVVRYTKEVYVPSPSNSEAVDLVTRLPEGAVLYKTFVHVVPAKPEGTFKLVAML |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein BL27m; MRP-L27; L27mt; Mitochondrial Ribosomal Protein L27 |
| Gene ID | 510058 |
| UniProt ID | Q32PC3 |
| Location | Mitochondrion |
| Introduction | MRPL27 is a fundamental constituent of the large ribosomal subunit within the mitochondrial ribosome of eukaryotic organisms. Alterations in MRPL27 can impair mitochondrial ribosomal function, potentially leading to mitochondrial dysfunction. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
