Recombinant Protein of Bovine MRPL24, aa 10-216(Cat#: RIJL-0225-JL418)
This product is a recombinant bovine MRPL24 protein with specific tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL24 protein with specific tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 24.8 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 10-216aa |
| Sequence | ASKVTLPPNYRYGMSRPGSLADKKKNPPGTRRRRVAVEPIPEEDWHLFCGDRVEILEGKDAGKQGKVVQVIRQRNWVVVEGLNTHYRYVGKTVDFRGTMVPSEAPLLHNQVKLVDPMDRKPTEVEWRFTEAGERVRVSTRSGRIIPKPDVPRADGIVPETWIDGPKDTSVEDALEKTYVPRLKTLEEEVMEAMGIQETRRHKKVYWY |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRP-L24; Mitochondrial Large Ribosomal Subunit Protein UL24m; Mitochondrial Ribosomal Protein L24; Large Ribosomal Subunit Protein UL24m |
| Gene ID | 532203 |
| UniProt ID | Q3SYS0 |
| Location | Mitochondrion |
| Introduction | MRPL24, or Mitochondrial Ribosomal Protein L24, is an essential constituent of the large ribosomal subunit within the mitochondrial ribosome of eukaryotic cells. Alterations in MRPL24 can impair mitochondrial ribosomal function, potentially leading to mitochondrial dysfunction and associated diseases. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
