Recombinant Protein of Bovine MRPL10, aa 29-262(Cat#: RIJL-0225-JL394)
This product is a recombinant bovine MRPL10 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL10 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 22.8 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 29-262aa |
| Sequence | GSKAVTRHRRVMHFERQKLMAVTEYIAPKPVVNPRCLPPPPSPPQEETGLIRLLRREIAAVFRDNRMIAVCQNVAMSAEDKLLMRHQLRKHKILMKVFPNQILKPFLEDSKYQNLLPLFVGHNLLLVSEEPKVKEMVRILKSVPFLPLLGGCIDDTILSRQGFINYSKLPSLALAQGELVGGLTLLTARTHSLLQHHPLQLTALLDQYARQQHEGDPVVPASAQPDPPNPVQDS |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L10; Large Ribosomal Subunit Protein UL10m; MRPL8 |
| Gene ID | 515014 |
| UniProt ID | Q3MHY7 |
| Location | Mitochondrion |
| Introduction | MRPL10, or Mitochondrial Ribosomal Protein L10, is an indispensable element of the large ribosomal subunit in the mitochondrial ribosome of eukaryotic organisms. It plays a pivotal role in mitochondrial translation, facilitating the accurate assembly and function of the mitochondrial ribosome. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
