Recombinant Pongo abelii RRP7A, Full Length(Cat#: RIJL-1124-JL132)
This product is a recombinant pongo abelii RRP7A protein with specific tag. It is availible for Affinity purification, positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant pongo abelii RRP7A protein with specific tag. It is availible for Affinity purification, positive control and immunogen. |
Product Property
| Species Reactivity | Pongo abelii |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS with 6% trehalose |
| Residues | Full Length |
| Sequence | MVARRRKRAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHSVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSSCGPLQSVELQEKPDLADSPKESRSKFFHPKPVPGFRVGYVVFQKPSGVSAALALQGPLLVSTESHPVKTGIHKWISDYADSVPDPEALRVEVDTFMEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRTRKELLNFYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Affinity Purification; Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | RRP7A; Ribosomal RNA-processing protein 7 homolog A; Gastric cancer antigen Zg14 homolog |
| Gene ID | 100172751 |
| UniProt ID | Q5RA17 |
| Location | Cytoplasm |
| Introduction | RRP7A is capable of enabling RNA binding activity. RRP7A may be involved in rRNA processing and ribosomal small subunit assembly. RRP7A is closely associated with primary autosomal recessive microcephaly. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
