Recombinant Protein of Slime Mold EXOSC3, aa 1-237(Cat#: RIJL-1124-JL157)
This product is a recombinant slime mold EXOSC3 protein with specific tag. It is availible for SDS-PAGE, positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant slime mold EXOSC3 protein with specific tag. It is availible for SDS-PAGE, positive control and immunogen. |
Product Property
| Species Reactivity | Slime mold |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS with 6% trehalose |
| Residues | 1-237aa |
| Sequence | MDTLKDQFVVPGDVIGKIGDLKVRIGPGLLQTKDTVLATKAGVLRYSKFHRFYWIENEQKRYVPQVEDMVIGTIIEKHAESFKVDIGSSCSALLSAYSFEGATKSNKPLLNVGNLIYCRVTVANRDMEPEVVCLSQKQKAEGFGQLIGGYMLNCSLGLSHYLLSEDCFLLQILGKHIPYEIAVGVNGRVWINSGSNHNTIVVSNTIYNSQYIQDDQIEPFILKSLSINETSGLVEQN |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Component rrp40; Exosome component 3; Ribosomal RNA-processing protein 40 |
| Gene ID | 8620730 |
| UniProt ID | Q7KWX9 |
| Location | Cytoplasm |
| Introduction | The EXOSC3 gene encodes a non-catalytic component of the exosome, a complex with 3'-5' exoribonuclease activity that plays a role in multiple RNA processing and degradation events. Data show that the normal function of the EXOSC3 component is essential for the survival of cerebellar motor neurons. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
