Loading...
Book a Meeting

Recombinant Protein of Mouse EXOSC3, aa 2-274(Cat#: RIJL-1124-JL156)

This product is a recombinant mouse EXOSC3 protein with specific tag. It is availible for WB, positive control and immunogen.

Certificate of Analysis (COA)

To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].

Lot Number
Summary Related Products & Services

Description

This product is a recombinant mouse EXOSC3 protein with specific tag. It is availible for WB, positive control and immunogen.

Product Property

Species Reactivity Mouse
Purity >85% determined by SDS-PAGE
Endotoxin Low endotoxin
Expression Host Yeast; E.coli; Baculovirus; Mammalian Cell
Formulation PBS with 6% trehalose
Residues 2-274aa
Sequence AEVLSAGPESVAGCRARAVHKVLNQVVLPGEELVLPDHEDVDGLGGAGEQPLRLNAGARPRLRVVCGPGLRRCGDRLLVTKCGRLRHKEPSGGGGGVYWVDSQQKRYVPVKGDHVIGIVIAKSGDIFKVDVGGSEPASLSYLAFEGATKRNRPNVQVGDLIYGQCVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIVQELGKLYPLEIVFGMNGRIWVKAKTIQQTLILANVLEACEHMTTEQRKQIFARLAES
Product Form Lyophilized powder
Tags Tag type will be determined during the manufacturing process.
Type Recombinant Protein
Applications WB; Positive Control; Immunogen
Storage Store at -20°C/-80°C. Avoid freeze-thaw cycles.

Target

Alternative Names Exosc3; Rrp40Exosome complex component RRP40; Exosome component 3; Ribosomal RNA-processing protein 40
Gene ID 66362
UniProt ID Q7TQK4
Location Cytoplasm; Nucleus; Nucleolus
Introduction The EXOSC3 gene encodes a non-catalytic component of the exosome, a complex with 3'-5' exoribonuclease activity that plays a role in multiple RNA processing and degradation events. Data show that the normal function of the EXOSC3 component is essential for the survival of cerebellar motor neurons.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
Inquiry