Loading...
Book a Meeting

Recombinant Protein of Bovine EXOSC3, aa 2-275(Cat#: RIJL-1124-JL154)

This product is a recombinant bovine EXOSC3 protein with specific tag. It is availible for positive control and immunogen.

Certificate of Analysis (COA)

To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].

Lot Number
Summary Related Products & Services

Description

This product is a recombinant bovine EXOSC3 protein with specific tag. It is availible for positive control and immunogen.

Product Property

Species Reactivity Bovine
Purity >85% determined by SDS-PAGE
Endotoxin Low endotoxin
Expression Host Yeast; E.coli; Baculovirus; Mammalian Cell
Formulation PBS with 6% trehalose
Residues 2-275aa
Sequence AEAAGVPAESLAGCRARAARTVLDQVVLPGEELLLPDQEDGDGPGGAGERPLRLNAAARSRGRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLAFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEILQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTADQRKQIFSRLAES
Product Form Lyophilized powder
Tags Tag type will be determined during the manufacturing process.
Type Recombinant Protein
Applications Positive Control; Immunogen
Storage Store at -20°C/-80°C. Avoid freeze-thaw cycles.

Target

Alternative Names EXOSC3; RRP40 Exosome complex component RRP40; Exosome component 3; Ribosomal RNA-processing protein 40
Gene ID 533245
UniProt ID Q3T0E1
Location Cytoplasm; Nucleus; Nucleolus
Introduction The EXOSC3 gene encodes a non-catalytic component of the exosome, a complex with 3'-5' exoribonuclease activity that plays a role in multiple RNA processing and degradation events. Data show that the normal function of the EXOSC3 component is essential for the survival of cerebellar motor neurons.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
Inquiry