Loading...
Book a Meeting

Recombinant Protein of Rat RPL7, aa 1-239(Cat#: RIJL-1124-JL208)

This product is a recombinant rat RPL7 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.

Certificate of Analysis (COA)

To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].

Lot Number
Summary Related Products & Services

Description

This product is a recombinant rat RPL7 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.

Product Property

Species Reactivity Rat
Purity >85% determined by SDS-PAGE
Endotoxin Low endotoxin
Expression Host Yeast; E.coli; Baculovirus; Mammalian Cell
Formulation PBS with 6% trehalose
Residues 1-239aa
Sequence MSKFVPENVQKKLARDEKLRKAKAEQRKASSAQMKQRKAEWISKAQKYAAEYEAAEKKIVDEKRKARKTGAFYVPAEAKVAFAIRIRGVNQLHPDVKRVLRLFRLRQLHNGAFFRVNKASLNMIKRVLPFITFGYPTRNTISKLIYKRGFAKVNGQRIPLTDNTIVEKSLGKFGITCVEDLIHEITTVGPHFKEANNFLWPFKLDTPRGGFRNKRHAYHQGGDWGNREVYINDLVKAML
Product Form Lyophilized powder
Tags Tag type will be determined during the manufacturing process.
Type Recombinant Protein
Applications Immunogen; SDS-PAGE; WB
Storage Store at -20°C/-80°C. Avoid freeze-thaw cycles.

Target

Alternative Names Rpl7; 60S ribosomal protein L7
Gene ID 297755
UniProt ID P0DJ13
Location Cytoplasm
Introduction RPL7 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30P family of ribosomal proteins.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
Inquiry