Recombinant Protein of Rat RPL7, aa 1-239(Cat#: RIJL-1124-JL208)
This product is a recombinant rat RPL7 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant rat RPL7 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
Species Reactivity |
Rat |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
Low endotoxin |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
PBS with 6% trehalose |
Residues |
1-239aa |
Sequence |
MSKFVPENVQKKLARDEKLRKAKAEQRKASSAQMKQRKAEWISKAQKYAAEYEAAEKKIVDEKRKARKTGAFYVPAEAKVAFAIRIRGVNQLHPDVKRVLRLFRLRQLHNGAFFRVNKASLNMIKRVLPFITFGYPTRNTISKLIYKRGFAKVNGQRIPLTDNTIVEKSLGKFGITCVEDLIHEITTVGPHFKEANNFLWPFKLDTPRGGFRNKRHAYHQGGDWGNREVYINDLVKAML |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Immunogen; SDS-PAGE; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Rpl7; 60S ribosomal protein L7 |
Gene ID |
297755 |
UniProt ID |
P0DJ13 |
Location |
Cytoplasm |
Introduction |
RPL7 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30P family of ribosomal proteins. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.