Recombinant Protein of Rat RPL13, aa 1-211(Cat#: RIJL-0225-JL254)
This product is a recombinant rat RPL13 protein with N-terminal His Tag. It is availible for SDS-PAGE, WB, ELISA, bioactivity testing and immunogen.
Summary
Related Products & Services
Description
|
This product is a recombinant rat RPL13 protein with N-terminal His Tag. It is availible for SDS-PAGE, WB, ELISA, bioactivity testing and immunogen. |
Product Property
Species Reactivity |
Rat |
Molecule Mass |
24.3 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
E.coli |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
1-211aa |
Sequence |
MAPSRNGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKMARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARAITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK |
Product Form |
Lyophilized powder |
Tags |
N-terminal His Tag |
Type |
Recombinant Protein |
Applications |
SDS-PAGE; WB; ELISA; Bioactivity Testing; Immunogen |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
60S Ribosomal Protein L13; Ribosomal Protein L13; D16S444E; Large Ribosomal Subunit Protein EL13 |
Gene ID |
81765 |
UniProt ID |
P41123 |
Location |
Cytoplasm |
Introduction |
RPL13 is a component of the ribosome, a large ribonucleoprotein complex responsible for synthesizing proteins within cells. The ribosome comprises the small ribosomal subunit (SSU), which binds messenger RNAs (mRNAs) and translates the encoded message by selecting corresponding aminoacyl-transfer RNA (tRNA) molecules, and the large subunit (LSU), which harbors the ribosomal catalytic site known as the peptidyl transferase center (PTC). As an integral part of the LSU, RPL13 is likely essential for its formation and the maturation of ribosomal RNAs. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.