Recombinant Protein of Mouse RPL9, aa 1-192(Cat#: RIJL-0225-JL239)
This product is a recombinant mouse RPL9 protein with specific tag. It is availible for immunogen, SDS-PAGE, positive control and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse RPL9 protein with specific tag. It is availible for immunogen, SDS-PAGE, positive control and WB. |
Product Property
Species Reactivity |
Mouse |
Molecule Mass |
21.9 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
1-192aa |
Sequence |
MKTILSNQTVDIPENVEITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Immunogen; SDS-PAGE; Positive Control; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Ribosomal Protein L9; 60S Ribosomal Protein L9; Large Ribosomal Subunit Protein UL6 |
Gene ID |
20005 |
UniProt ID |
P51410 |
Location |
Cytoplasm |
Introduction |
RPL9 encodes a ribosomal protein that is an integral part of the 60S subunit and belongs to the L6P family of ribosomal proteins. Situated in the cytoplasm, this protein plays a crucial role in ribosomal function. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.