Recombinant Protein of Bovine RPL9, aa 1-192(Cat#: RIJL-0225-JL238)
This product is a recombinant bovine RPL9 protein with specific tag. It is availible for standard, WB, positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine RPL9 protein with specific tag. It is availible for standard, WB, positive control and immunogen. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 21.9 kDa |
| Purity | >80% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-192aa |
| Sequence | MKTILSNQTVDIPENVDINLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Standard; WB; Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein UL6; Ribosomal Protein L9; 60S Ribosomal Protein L9 |
| Gene ID | 282884 |
| UniProt ID | Q3SYR7 |
| Location | Cytoplasm |
| Introduction | RPL9 encodes a ribosomal protein that is an integral part of the 60S subunit and belongs to the L6P family of ribosomal proteins. Situated in the cytoplasm, this protein plays a crucial role in ribosomal function. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
