Recombinant Protein of Mouse MRPS28, aa 71-186(Cat#: RIJL-0225-JL524)
This product is a recombinant mouse MRPS28 protein with specific tag. It is availible for standard, immunogen and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse MRPS28 protein with specific tag. It is availible for standard, immunogen and SDS-PAGE. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 20.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 71-186aa |
| Sequence | ESPKPVESFASMLRHSPLTQLGPAKDKLVIGRIFHIVEDDLYIDFGGKFHCVCKRPDVDGEKYQRGTRVRLRLLDLELTSRFLGGTTDTTILEADAVLLGLQEIRDSKSREEQPSK |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Standard; Immunogen; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein S28; MRP-S28; Mitochondrial 28S Ribosomal Protein S35; 28S Ribosomal Protein S28, Mitochondrial |
| Gene ID | 66230 |
| UniProt ID | Q9CY16 |
| Location | Mitochondrion |
| Introduction | MRPS28 protein is exclusively localized within the mitochondria, where it facilitates the accurate translation of mitochondrial genetic information into functional proteins essential for cellular respiration and energy production. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
