Recombinant Protein of Human MRPS28, aa 72-187(Cat#: RIJL-0225-JL522)
This product is a recombinant human MRPS28 protein with N-terminal His-IF2DI Tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS28 protein with N-terminal His-IF2DI Tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 12.7 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | 10 mM Hepes, 150 mM NaCl with 5% trehalose, pH 7.4 |
| Residues | 72-187aa |
| Sequence | GSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK |
| Product Form | Lyophilized powder |
| Tags | N-terminal His-IF2DI Tag |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRP-S28; 28S Ribosomal Protein S28, Mitochondrial; Mitochondrial Ribosomal Protein S28; Mitochondrial 28S Ribosomal Protein S35 |
| Gene ID | 28957 |
| UniProt ID | Q9Y2Q9 |
| Location | Mitochondrion |
| Introduction | MRPS28 protein is exclusively localized within the mitochondria, where it facilitates the accurate translation of mitochondrial genetic information into functional proteins essential for cellular respiration and energy production. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
