Recombinant Protein of Bovine MRPS28, aa 73-189(Cat#: RIJL-0225-JL523)
This product is a recombinant bovine MRPS28 protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine MRPS28 protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity |
Bovine |
| Molecule Mass |
21.0 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
E.coli |
| Formulation |
Tris/PBS-based buffer, 6% Trehalose |
| Residues |
73-189aa |
| Sequence |
GSPKNVESFASMLRHSPLTQMGPAKDKIVIGRIFHIVENDLYIDFGGKFHCVCKRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTILEAEAVLLGLQESKDSKSKEERRENK |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
WB; Bioactivity Testing; Immunogen; ELISA; SDS-PAGE |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Mitochondrial Ribosomal Protein S28; MRP-S28; 28S Ribosomal Protein S28, Mitochondrial; Mitochondrial 28S Ribosomal Protein S35 |
| Gene ID |
535290 |
| UniProt ID |
P82928 |
| Location |
Mitochondrion |
| Introduction |
MRPS28 protein is exclusively localized within the mitochondria, where it facilitates the accurate translation of mitochondrial genetic information into functional proteins essential for cellular respiration and energy production. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.