Recombinant Protein of Mouse MRPS26, aa 28-200(Cat#: RIJL-0225-JL518)
This product is a recombinant mouse MRPS26 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse MRPS26 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 23.4 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 28-200aa |
| Sequence | KTRHDPPAKSKVGRVQTPPAVDPAEFFVLTERYRQYRETVRALRLEFTLEVRRKLHEARAGVLAERKAQQAITEHRELMAWNRDENRRMQELRIARLQLEAQAQEVQKAEAQAQRAQEEQAWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDSPKSYNWAVTKEGQVVRN |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | S13mt; S26mt; MRP-S26; MRPS13; MRPS26; C20orf193; MRP-S13; NY-BR-87; RPMS13 |
| Gene ID | 99045 |
| UniProt ID | Q80ZS3 |
| Location | Mitochondrion |
| Introduction | MRPS26 protein functions as a vital element within the small subunit of the mitochondrial ribosome, playing a crucial part in the biosynthesis of mitochondrial proteins. Genetic mutations or alterations affecting the MRPS26 gene have been associated with a variety of mitochondrial diseases, notably including Leigh syndrome, a profound neurodegenerative disorder, as well as other genetic conditions marked by impaired oxidative phosphorylation and subsequent cellular energy deficiencies. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
