Recombinant Protein of Mouse MRPL33, aa 1-65(Cat#: RIJL-0225-JL426)
This product is a recombinant mouse MRPL33 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse MRPL33 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 7.4 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-65aa |
| Sequence | MLLSAVSFAKSKSKTILVKLVSQAGTGFSFNHKRSRLREKLSLLHYDPIVNKKVLFVEQKKIRSL |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRP-L33; Mitochondrial Large Ribosomal Subunit Protein BL33m; Mitochondrial Ribosomal Protein L33; RPL33L; Large Ribosomal Subunit Protein BL33m |
| Gene ID | 66845 |
| UniProt ID | Q9CQP0 |
| Location | Mitochondrion |
| Introduction | MRPL33, short for Mitochondrial Ribosomal Protein L33, is a fundamental constituent of the large subunit of the mitochondrial ribosome. As a key player in the mitochondrial translational machinery, MRPL33 ensures the fidelity and efficiency of ribosomal function, contributing to the overall health and vitality of the cell. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
