Recombinant Protein of Human RPN1, aa 272-517(Cat#: RIJL-1124-JL178)
This product is a recombinant human RPN1 protein with N-terminal His and GST tag. It is availible for SDS-PAGE, positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human RPN1 protein with N-terminal His and GST tag. It is availible for SDS-PAGE, positive control and immunogen. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 58kDa |
| Purity | >80% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | 20mM Tris, 150mM NaCl, pH 8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% trehalose and proclin 300 |
| Residues | 272-517aa |
| Sequence | SGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK |
| Product Form | Lyophilized powder |
| Tags | N-terminal His |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | RPNI; Ribophorin I; OST1; RBPH1; Dolichyl-Diphosphooligosaccharide-Protein Glycosyltransferase Subunit 1 |
| Gene ID | 6184 |
| UniProt ID | P04843 |
| Location | Endoplasmic reticulum lumen |
| Introduction | The RPN1 gene encodes a type I integral membrane protein only found in rough endoplasmic reticulum. RPN1 protein is part of the N-oligosaccharyltransferase complex. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate the association of ubiquitin-like domains with this proteasome. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
