Recombinant Protein of Human MRPL45, aa 92-265(Cat#: RIJL-0225-JL442)
This product is a recombinant human MRPL45 protein with N-terminal His Tag. It is availible for immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL45 protein with N-terminal His Tag. It is availible for immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 22.8 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol |
| Residues | 92-265aa |
| Sequence | EGDARISSLSKEGLIERTERMKKTMASQVSIRRIKDYDANFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMTWDIKYKTVRWSFVESLEPSHVVQVRCSSMMNQGNVYGQITVRMHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFEKQLTNPYGSWRMHTKI |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L45; Large Ribosomal Subunit Protein ML45; MRP-L45; Mitochondrial Large Ribosomal Subunit Protein ML45 |
| Gene ID | 84311 |
| UniProt ID | Q9BRJ2 |
| Location | Mitochondrion |
| Introduction | MRPL45 protein is essential for the proper functioning of the mitochondrial ribosome, which in turn is vital for energy production within cells. Mutations or alterations in the MRPL45 gene can lead to disruptions in mitochondrial protein synthesis. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
