Recombinant Protein of Human EXOSC4, aa 1-245(Cat#: RIJL-1124-JL158)
This product is a recombinant human EXOSC4 protein with N-terminal His tag. It is availible for positive control, immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human EXOSC4 protein with N-terminal His tag. It is availible for positive control, immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 30.1 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | PBS, pH 7.4, containing 0.01% SKL and 5% trehalose |
| Residues | 1-245aa |
| Sequence | MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDR ALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQIHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHE DHLERVLEAAAQAARDVHTLLDRVVRQHVREASILLGD |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | Positive Control; Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | RRP41A; Rrp41p; SKI6; Ski6p; hRrp41p; p12A; Ribosomal RNA-processing protein 41 |
| Gene ID | 54512 |
| UniProt ID | Q9NPD3 |
| Location | Nucleus; Cytoplasm |
| Introduction | The EXOSC4 gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in multiple RNA processing and degradation activitie |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
