Recombinant Protein of Mouse EXOSC4, aa 2-245(Cat#: RIJL-1124-JL159)
This product is a recombinant mouse EXOSC4 protein with specific tag. It is availible for Affinity purification, positive control and immunogen.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse EXOSC4 protein with specific tag. It is availible for Affinity purification, positive control and immunogen. |
Product Property
| Species Reactivity |
Mouse |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
Low endotoxin |
| Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation |
PBS with 6% trehalose |
| Residues |
2-245aa |
| Sequence |
AGLELLSDQGYRIDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRSRALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVMDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDSRLHEDHLEQVLEAAAQAARGVHTLLDLVVRQHVQEASVSLGD |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
Affinity Purification; Positive Control; Immunogen |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Exosc4; Rrp41Exosome complex component RRP41; Exosome component 4; Ribosomal RNA-processing protein 41 |
| Gene ID |
109075 |
| UniProt ID |
Q921I9 |
| Location |
Cytoplasm; Nucleus; Nucleolus |
| Introduction |
The EXOSC4 gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in multiple RNA processing and degradation activitie |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.