Recombinant Protein of Bovine EXOSC4, aa 2-245(Cat#: RIJL-1124-JL160)
This product is a recombinant bovine EXOSC4 protein with specific tag. It is availible for positive control and immunogen.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine EXOSC4 protein with specific tag. It is availible for positive control and immunogen. |
Product Property
Species Reactivity |
Bovine |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
Low endotoxin |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
PBS with 6% trehalose |
Residues |
2-245aa |
Sequence |
AGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHLEQVLEAAARASRDVHTVLDRVVRQHVQEASVLLGD |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Positive Control; Immunogen |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
EXOSC4; RRP41Exosome complex component RRP41; Exosome component 4; Ribosomal RNA-processing protein 41 |
Gene ID |
618292 |
UniProt ID |
Q7YRA3 |
Location |
Cytoplasm; Nucleus; Nucleolus |
Introduction |
The EXOSC4 gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in multiple RNA processing and degradation activitie |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.