Recombinant Protein of Bovine EXOSC4, aa 2-245(Cat#: RIJL-1124-JL160)
This product is a recombinant bovine EXOSC4 protein with specific tag. It is availible for positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine EXOSC4 protein with specific tag. It is availible for positive control and immunogen. |
Product Property
| Species Reactivity | Bovine |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS with 6% trehalose |
| Residues | 2-245aa |
| Sequence | AGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHLEQVLEAAARASRDVHTVLDRVVRQHVQEASVLLGD |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | EXOSC4; RRP41Exosome complex component RRP41; Exosome component 4; Ribosomal RNA-processing protein 41 |
| Gene ID | 618292 |
| UniProt ID | Q7YRA3 |
| Location | Cytoplasm; Nucleus; Nucleolus |
| Introduction | The EXOSC4 gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in multiple RNA processing and degradation activitie |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
