Recombinant Protein of Bovine MRPL54, aa 17-138(Cat#: RIJL-0225-JL458)
This product is a recombinant bovine MRPL54 protein with specific tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL54 protein with specific tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 15.9 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 17-138aa |
| Sequence | RAWELPDPAGSVRLHVRDYAKRPVFKGGKGAKGAAVGETLKDPEVCTDPVQLTTHPMGVNIYKEGQDVVLKPDSEYPEWLFQMNVGPPKKLEELDPETREYWRLLRKHNIWRHNRLSKNQKF |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; Bioactivity Testing; Immunogen; ELISA; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | L54mt; Mitochondrial Large Ribosomal Subunit Protein ML54; Mitochondrial Ribosomal Protein L54; Large Ribosomal Subunit Protein ML54; MRP-L54 |
| Gene ID | 511926 |
| UniProt ID | Q3MHJ5 |
| Location | Mitochondrion |
| Introduction | MRPL54 is ubiquitously distributed across various tissues and organs, highlighting its widespread importance in cellular energy production. Mutations or dysregulation of MRPL54 have been implicated in a range of mitochondrial disorders, including mitochondrial myopathies and neurological conditions. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
