Recombinant Protein of Bovine MRPL3, aa 1-348(Cat#: RIJL-0225-JL388)
This product is a recombinant bovine MRPL3 protein with specific tag. It is availible for ELISA and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL3 protein with specific tag. It is availible for ELISA and WB. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 38.6 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-348aa |
| Sequence | MPGWRLLAWAGARVLDRGTGGLGTALGSGNRTDICVLVRSLHGKSGTWWDEHLSEENVSFVKQLVSDENKAQLASKLCPLKDEPWPIHPWEPGSSRVGLVALKLGMMPLWTKDGKKHVVTLLQVQDCHVLKYTPKENHNGKMAALTVGGKTVSRFHKSTSILEFYQELGLPPKQKIKMFNVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAISTGDVARVWPGTKMPGQLGNVDRTAFGLKVWRINTKHNIIYVNGSVPGHRNCLVKIKDSVLPAYKDFCKNLPFPTYFPDEDEKELPEDLYDEEVCQPGAPSITFV |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | ELISA; Western Blot |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein UL3m; Mitochondrial 60S Ribosomal Protein L3; Mitochondrial Ribosomal Protein L3; MRL3 |
| Gene ID | 614906 |
| UniProt ID | Q3ZBX6 |
| Location | Mitochondrion |
| Introduction | MRPL3, or Mitochondrial Ribosomal Protein L3, is a fundamental component of the large ribosomal subunit within the mitochondrial ribosome of eukaryotic cells. It plays a crucial role in mitochondrial translation, which is essential for the synthesis of proteins involved in oxidative phosphorylation and other critical mitochondrial functions. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
