Recombinant Protein of Bovine MRPL14, aa 31-145(Cat#: RIJL-0225-JL400)
This product is a recombinant bovine MRPL14 protein with specific tag. It is availible for standard, immunogen and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL14 protein with specific tag. It is availible for standard, immunogen and SDS-PAGE. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 15.9 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 31-145aa |
| Sequence | AIQKMTRVRVVDNSALGNTPYHRPPRCIHVYNKNGVGKVGDRILLAIKGQKKKALIVGHRMPGPTMTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLRQREGEFSKVLAIAQNFV |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Standard; Immunogen; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein UL14m; Mitochondrial Large Ribosomal Subunit Protein UL14m; Mitochondrial Ribosomal Protein L14; RPML32 |
| Gene ID | 614579 |
| UniProt ID | Q1JQ99 |
| Location | Mitochondrion |
| Introduction | MRPL14 is a core component of the large ribosomal subunit within the mitochondrial ribosome of eukaryotic cells. It plays a fundamental role in mitochondrial translation, ensuring the accurate and efficient synthesis of proteins involved in oxidative phosphorylation and other vital mitochondrial functions. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
