Recombinant Protein of Rat MRPL41, aa 14-134(Cat#: RIJL-0225-JL437)
This product is a recombinant rat MRPL41 protein with specific tag. It is availible for SDS-PAGE, WB, bioactivity testing, ELISA and immunogen.
Summary
Related Products & Services
Description
|
This product is a recombinant rat MRPL41 protein with specific tag. It is availible for SDS-PAGE, WB, bioactivity testing, ELISA and immunogen. |
Product Property
| Species Reactivity |
Rat |
| Molecule Mass |
15.2 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
E.coli |
| Formulation |
Tris/PBS-based buffer, 6% Trehalose |
| Residues |
14-134aa |
| Sequence |
GADRMSKWTSKRGPRTFTKSRGAKKTGFYTNRKFVQIKEMVPEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFLETVAPAIEKDFKEGTFDANNLEKYGFEPTQEGKLFQLYPKNFPR |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
SDS-PAGE; WB; Bioactivity Testing; ELISA; Immunogen |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Mitochondrial Ribosomal Protein L41; RPML27; Bcl-2-Interacting Mitochondrial Ribosomal Protein L41; Cell Proliferation-Inducing Gene 3 Protein; Large Ribosomal Subunit Protein ML41; 9S Ribosomal Protein L27 Homolog |
| Gene ID |
296551 |
| UniProt ID |
Q5BJX1 |
| Location |
Mitochondrion |
| Introduction |
MRPL41 serves as an indispensable part of the large subunit within the mitochondrial ribosome. It plays a pivotal role in ensuring the precise interpretation of genetic data inscribed in mitochondrial DNA, thereby guaranteeing the accurate assembly and optimal functionality of respiratory chain complexes. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.