Recombinant Protein of Mouse MRPL41, aa 14-135(Cat#: RIJL-0225-JL436)
This product is a recombinant mouse MRPL41 protein with specific tag. It is availible for immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse MRPL41 protein with specific tag. It is availible for immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 15.3 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 14-135aa |
| Sequence | GADRMSKWTSKRGPRTFTKSRGAKKTGIYTSDRKFVQIKEMVPEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFQETVAPAIEKDFKEGTFDANNLEKYGFEPTQEGKLFQLYPKNFPR |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Cell Proliferation-Inducing Gene 3 Protein; Large Ribosomal Subunit Protein ML41; 9S Ribosomal Protein L27 Homolog; Mitochondrial Ribosomal Protein L41; RPML27; Bcl-2-Interacting Mitochondrial Ribosomal Protein L41 |
| Gene ID | 107733 |
| UniProt ID | Q9CQN7 |
| Location | Mitochondrion |
| Introduction | MRPL41 serves as an indispensable part of the large subunit within the mitochondrial ribosome. It plays a pivotal role in ensuring the precise interpretation of genetic data inscribed in mitochondrial DNA, thereby guaranteeing the accurate assembly and optimal functionality of respiratory chain complexes. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
