Recombinant Protein of Pig RPS20, aa 2-119(Cat#: RIJL-0225-JL366)
This product is a recombinant pig RPS20 protein with specific tag. It is availible for standard, immunogen and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant pig RPS20 protein with specific tag. It is availible for standard, immunogen and SDS-PAGE. |
Product Property
| Species Reactivity | Pig |
| Molecule Mass | 13.4 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-119aa |
| Sequence | AFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIPKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Standard; Immunogen; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Small Ribosomal Subunit Protein US10; 40S Ribosomal Protein S20; Ribosomal Protein S20 |
| Gene ID | 414395 |
| UniProt ID | A1XQU9 |
| Location | Cytoplasm |
| Introduction | RPS20 protein plays a crucial role in the translation process. This highly conserved protein ensures the accuracy and efficiency of protein synthesis by facilitating the assembly and stability of the ribosomal complex. Understanding the function and regulation of RPS20 is pivotal for insights into ribosomal biology and the pathobiology of related genetic conditions. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
