Recombinant Protein of Mouse RPL36, aa 2-105(Cat#: RIJL-0225-JL300)
This product is a recombinant mouse RPL36 protein with specific tag. It is availible for WB, bioactivity testing, ELISA, immunogen and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPL36 protein with specific tag. It is availible for WB, bioactivity testing, ELISA, immunogen and SDS-PAGE. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 12.2 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-105aa |
| Sequence | ALRYPMAVGLNKGHKVTKNVSKPRHSRRRSRLTNHTKFVRDMIREVCGFAPYERRAMELLKVSKSKRALKFIKKRVGTHIRAKRKREELSNVLAAMEEAAAKKD |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Bioactivity Testing; ELISA; Immunogen; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal Protein L36; Large Ribosomal Subunit Protein EL36; 60S Ribosomal Protein L36 |
| Gene ID | 54217 |
| UniProt ID | P47964 |
| Location | Cytoplasm |
| Introduction | The RPL36 protein is a fundamental constituent of the 60S ribosomal subunit. It is essential for the structural integrity and functional efficiency of the ribosome, contributing to the accurate translation of genetic information into functional proteins. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
