Recombinant Protein of Mouse RPL12, aa 1-165(Cat#: RIJL-0225-JL251)
This product is a recombinant mouse RPL12 protein with specific tag. It is availible for positive control, immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPL12 protein with specific tag. It is availible for positive control, immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 17.8 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-165aa |
| Sequence | MPPKFDPNEVKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Positive Control; Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein UL11; 60S Ribosomal Protein L12; Ribosomal Protein L12 |
| Gene ID | 269261 |
| UniProt ID | P35979 |
| Location | Cytoplasm |
| Introduction | RPL12 is a constituent of the large ribosomal subunit, within the ribosome, a substantial ribonucleoprotein complex dedicated to synthesizing proteins within cells. It binds directly to 26S ribosomal RNA. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
