Recombinant Protein of Human RPL12, aa 1-165(Cat#: RIJL-0225-JL250)
This product is a recombinant human RPL12 protein with N-terminal His Tag or N-terminal His-IF2DI Tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human RPL12 protein with N-terminal His Tag or N-terminal His-IF2DI Tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 18 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | 10 mM Hepes, 150 mM NaCl with 5% trehalose, pH 7.4 |
| Residues | 1-165aa |
| Sequence | MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag; N-terminal His-IF2DI Tag |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal Protein L12; Large Ribosomal Subunit Protein UL11; 60S Ribosomal Protein L12 |
| Gene ID | 6136 |
| UniProt ID | P30050 |
| Location | Cytoplasm |
| Introduction | RPL12 is a human protein encoded by the RPL12 gene and belongs to the L11P family of ribosomal proteins. This protein resides in the cytoplasm and directly binds to the 26S rRNA. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
