Recombinant Protein of Mouse MRPS5, aa 1-430(Cat#: RIJL-0225-JL469)
This product is a recombinant mouse MRPS5 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse MRPS5 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity |
Mouse |
| Molecule Mass |
48.2 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation |
Tris/PBS-based buffer, 6% Trehalose |
| Residues |
1-430aa |
| Sequence |
MAAAVRAAGCLPALCSLQAGHFLSRQLSLNAFPVAATSFLAVKTALSHGSLSSRETRRNHCLTSLSHVLQTQCCVSSPGNWTGQQCRPYSFFTKLTAEELWKGALAETGAGARKGRGKRTKKKKRKDLNRGQIIGEGRSGFLWPGLNVPLIKSGVVQNIGQRSKEEQQKVEATMVEQREEWDRKRKIKVKRERGWSGNTWGGVSIGPPDPGPNGETYEDFDTRILEVRNVFNMTAKEGRKKSVRVLVAVGNGNGAAGFAIGKAADRGDAFRKAKNRAIHYLHYIERYEGHTIFHDISLRFKRTQIRMKKQPRGYGLRCHRAIITICRLIGIKDMYARVTGSMNMLNLTRGLFHGLARQETHQHLADKKGLHVVEFREECGPLPIVVASPHGALSKEPEPEPEVPDTKLDWQDVKAMQGLKRSVWFNLKRPAT |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Mitochondrial Small Ribosomal Subunit Protein US5m; Mitochondrial Ribosomal Protein S5; MRP-S5; Mitochondrial 28S Ribosomal Protein S5 |
| Gene ID |
77721 |
| UniProt ID |
Q99N87 |
| Location |
Mitochondrion |
| Introduction |
MRPS5 is a fundamental protein of the mitochondrial small ribosomal subunit, crucial for the translation of mitochondrial mRNAs into proteins. Mutations or deficiencies in MRPS5 have been implicated in a range of disorders, including mitochondrial myopathies and other metabolic diseases. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.