Recombinant Protein of Human MRPS5, aa 1-430(Cat#: RIJL-0225-JL467)
This product is a recombinant human MRPS5 protein with Flag Tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant human MRPS5 protein with Flag Tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity |
Human |
| Molecule Mass |
47.8 kDa |
| Purity |
>90% determined by SDS-PAGE |
| Endotoxin |
Low endotoxin |
| Expression Host |
293T Cells |
| Formulation |
25mM Tris-HCl, pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProtein inhibitor cocktail mix, 1mM PMSF and 1mM NA₃VO₄ |
| Residues |
1-430aa |
| Sequence |
MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPYASLSRALQTQCCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT |
| Product Form |
Lyophilized powder |
| Tags |
Flag Tag |
| Type |
Recombinant Protein |
| Applications |
Immunogen; SDS-PAGE; WB |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Mitochondrial 28S Ribosomal Protein S5; Mitochondrial Small Ribosomal Subunit Protein US5m; Mitochondrial Ribosomal Protein S5; MRP-S5 |
| Gene ID |
64969 |
| UniProt ID |
P82675 |
| Location |
Mitochondrion |
| Introduction |
MRPS5 is a fundamental protein of the mitochondrial small ribosomal subunit, crucial for the translation of mitochondrial mRNAs into proteins. Mutations or deficiencies in MRPS5 have been implicated in a range of disorders, including mitochondrial myopathies and other metabolic diseases. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.