Recombinant Protein of Human MRPL55, aa 1-128(Cat#: RIJL-0225-JL460)
This product is a recombinant human MRPL55 protein with Flag Tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL55 protein with Flag Tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 18.7 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | 293T Cells |
| Formulation | 25mM Tris-HCl, pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProtein inhibitor cocktail mix, 1mM PMSF and 1mM NA₃VO₄ |
| Residues | 1-128aa |
| Sequence | MAAVGSLLGLAASSWLGGQNASDHSLWLLRKPRGSSCPGTGHQLCRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK |
| Product Form | Lyophilized powder |
| Tags | Flag Tag |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; Bioactivity Testing; Immunogen; ELISA; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L55; Mitochondrial Large Ribosomal Subunit Protein BL31m; Large Ribosomal Subunit Protein ML55; MRP-L55; L55mt; Mitochondrial Large Ribosomal Subunit Protein ML55 |
| Gene ID | 128308 |
| UniProt ID | Q7Z7F7 |
| Location | Mitochondrion |
| Introduction | MRPL55 is a pivotal protein within the mitochondrial ribosomal complex, specifically belonging to the large ribosomal subunit. MRPL55 is found in all cells that contain mitochondria, reflecting its ubiquitous and essential nature. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
