Loading...
Book a Meeting

Recombinant Protein of Human MRPL55, aa 1-128(Cat#: RIJL-0225-JL460)

This product is a recombinant human MRPL55 protein with Flag Tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB.

Certificate of Analysis (COA)

To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].

Lot Number
Summary Related Products & Services

Description

This product is a recombinant human MRPL55 protein with Flag Tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB.

Product Property

Species Reactivity Human
Molecule Mass 18.7 kDa
Purity >90% determined by SDS-PAGE
Endotoxin Low endotoxin
Expression Host 293T Cells
Formulation 25mM Tris-HCl, pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProtein inhibitor cocktail mix, 1mM PMSF and 1mM NA₃VO₄
Residues 1-128aa
Sequence MAAVGSLLGLAASSWLGGQNASDHSLWLLRKPRGSSCPGTGHQLCRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
Product Form Lyophilized powder
Tags Flag Tag
Type Recombinant Protein
Applications SDS-PAGE; Bioactivity Testing; Immunogen; ELISA; WB
Storage Store at -20°C/-80°C. Avoid freeze-thaw cycles.

Target

Alternative Names Mitochondrial Ribosomal Protein L55; Mitochondrial Large Ribosomal Subunit Protein BL31m; Large Ribosomal Subunit Protein ML55; MRP-L55; L55mt; Mitochondrial Large Ribosomal Subunit Protein ML55
Gene ID 128308
UniProt ID Q7Z7F7
Location Mitochondrion
Introduction MRPL55 is a pivotal protein within the mitochondrial ribosomal complex, specifically belonging to the large ribosomal subunit. MRPL55 is found in all cells that contain mitochondria, reflecting its ubiquitous and essential nature.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
Inquiry