Recombinant Protein of Bovine MRPL55, aa 35-126(Cat#: RIJL-0225-JL461)
This product is a recombinant bovine MRPL55 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine MRPL55 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
Species Reactivity |
Bovine |
Molecule Mass |
15.0 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
E.coli |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
35-126aa |
Sequence |
DCNRASLTRVHRQTYARLYPILLVKQDGSTIHIRYPEPRRILTMPVDLDSLSPEERRARFRKREGQLKEKKEEPELADDFDVEQYKQFWTKK |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Immunogen; SDS-PAGE; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Large Ribosomal Subunit Protein ML55; MRP-L55; L55mt; Mitochondrial Large Ribosomal Subunit Protein ML55; Mitochondrial Ribosomal Protein L55; Mitochondrial Large Ribosomal Subunit Protein BL31m |
Gene ID |
506657 |
UniProt ID |
P0C2B8 |
Location |
Mitochondrion |
Introduction |
MRPL55 is a pivotal protein within the mitochondrial ribosomal complex, specifically belonging to the large ribosomal subunit. MRPL55 is found in all cells that contain mitochondria, reflecting its ubiquitous and essential nature. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.