Recombinant Protein of Bovine MRPL55, aa 35-126(Cat#: RIJL-0225-JL461)
This product is a recombinant bovine MRPL55 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL55 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 15.0 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 35-126aa |
| Sequence | DCNRASLTRVHRQTYARLYPILLVKQDGSTIHIRYPEPRRILTMPVDLDSLSPEERRARFRKREGQLKEKKEEPELADDFDVEQYKQFWTKK |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein ML55; MRP-L55; L55mt; Mitochondrial Large Ribosomal Subunit Protein ML55; Mitochondrial Ribosomal Protein L55; Mitochondrial Large Ribosomal Subunit Protein BL31m |
| Gene ID | 506657 |
| UniProt ID | P0C2B8 |
| Location | Mitochondrion |
| Introduction | MRPL55 is a pivotal protein within the mitochondrial ribosomal complex, specifically belonging to the large ribosomal subunit. MRPL55 is found in all cells that contain mitochondria, reflecting its ubiquitous and essential nature. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
