Recombinant Protein of Human MRPL1, aa 147-285(Cat#: RIJL-1124-JL180)
This product is a recombinant human MRPL1 protein with N-terminal His tag. It is availible for SDS-PAGE, WB, ELISA and IP.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL1 protein with N-terminal His tag. It is availible for SDS-PAGE, WB, ELISA and IP. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 20 kDa |
| Purity | >80% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | PBS, pH 7.4, containing 0.01% SKL and 5% trehalose |
| Residues | 147-285aa |
| Sequence | PYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLN |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; ELISA; IP |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L1; BM022; 39S Ribosomal Protein L1, Mitochondrial; Large Ribosomal Subunit Protein UL1m |
| Gene ID | 65008 |
| UniProt ID | Q9BYD6 |
| Location | Mitochondrion |
| Introduction | MRPL1 protein is encoded by the MRPL1 gene and plays a vital function in protein synthesis within mitochondria. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
