Recombinant Protein of Bovine MRPL1, aa 51-325(Cat#: RIJL-1124-JL182)
This product is a recombinant bovine MRPL1 protein with specific tag. It is availible for SDS-PAGE, positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL1 protein with specific tag. It is availible for SDS-PAGE, positive control and immunogen. |
Product Property
| Species Reactivity | Bovine |
| Purity | >80% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS with 6% trehalose |
| Residues | 51-325aa |
| Sequence | KKTKKGTKEKASNEKKDDIEKIKSYPFMEGEPEDDVYLKRLYPRQIYEVEKAVNLLKKFQVLDFTNPKQGVYLDLTLDMTLGKKKKVEPFASVLSLPYPFISEMSKVAVFTGNASEIKIAEENGAAFAGGTNLIQKILDDEIQADFYIAVPEIMPELNPLRKKLKTRFPKFNRNSVGRDIPKMLELFKTGLEIKVDEERENFLETKIATLDMPSDQIAANLQAVINEVCRQRPLNLGPFVVRAFLRSSTSEGLLLKIEPLLPKEGETKESDKKAV |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRPL1; 39S ribosomal protein L1; mitochondrial; L1mt; MRP-L1 |
| Gene ID | 504835 |
| UniProt ID | A6QPQ5 |
| Location | Mitochondrion |
| Introduction | MRPL1 protein is encoded by the MRPL1 gene and plays a vital function in protein synthesis within mitochondria. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
