Recombinant Protein of Bovine MRPS18B, aa 1-258(Cat#: RIJL-0225-JL501)
This product is a recombinant bovine MRPS18B protein with specific tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPS18B protein with specific tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 29.2 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-258aa |
| Sequence | MAASVLNVLLRRLPYFSPFRGAYGVQVPLQTLCTKAPPEDDSLPPIPVSPYEDEPWKYLDSEEYHNRNGSRPVWADYRRNHKGGIPPQRTRKMCIRGNKVAGNPCPICRDQKLHVDFRNVKLLKQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLSYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGHLREESGPPPESMPKVPLTAPNEATSTEQAGPQSAL |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRP-S18-b; Mrps18-b; MRP-S18-2; MRPS18B; 28S ribosomal protein S18b |
| Gene ID | 510824 |
| UniProt ID | P82918 |
| Location | Mitochondrion |
| Introduction | The MRPS18B protein is uniquely localized within the mitochondria, where it plays a pivotal role in facilitating the assembly and operation of the mitochondrial ribosome. Essential for sustaining efficient energy production via oxidative phosphorylation, the MRPS18B protein is indispensable for maintaining metabolic homeostasis. Alterations, including mutations or deletions, in the MRPS18B gene have been associated with a diverse array of mitochondrial disorders, notably including combined oxidative phosphorylation deficiencies. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
