Recombinant Protein of Rat RRP15, aa 2-280(Cat#: RIJL-1124-JL147)
This product is a recombinant rat RRP15 protein with specific tag. It is availible for WB, positive control and immunogen.
Summary
Related Products & Services
Description
|
This product is a recombinant rat RRP15 protein with specific tag. It is availible for WB, positive control and immunogen. |
Product Property
Species Reactivity |
Rat |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
Low endotoxin |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
PBS with 6% trehalose |
Residues |
2-280aa |
Sequence |
AAAVQDSRVNPGGKLKRSPKKKKKMKKVAKAAVSKLEDELKDSSGGEGSCESEMDDSDDGAAEADSEDNVESCEEENEVAAESSAGTNSGWADAMAKILNKKTPKSKPTILTKNKELEKEKEKLKQERLEKRKQIDKKREWEMLCRVKPDVIKDKEAERNLQRIATRGVVQLFNAVQKHQRNVDEKVKEVGGSIRKRAKLMSTVSKKDFISVLRGMDGASENSSAGKSPKARQTEVKSEEGPGWKILRDDFMMGASMKDWDKESEGEEPADGQAGSASH |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
WB; Positive Control; Immunogen |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Rrp15; RRP15-like protein; Ribosomal RNA-processing protein 15 |
Gene ID |
360895 |
UniProt ID |
Q5M947 |
Location |
Cytoplasm |
Introduction |
RRP15 is a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of the pre-60S ribosomal particle and is required for the early maturation steps of the 60S subunit. Scientists have found that RRP15 may be a promising target for cancer treatment. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.