Recombinant Protein of Rat RRP15, aa 2-280(Cat#: RIJL-1124-JL147)
This product is a recombinant rat RRP15 protein with specific tag. It is availible for WB, positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant rat RRP15 protein with specific tag. It is availible for WB, positive control and immunogen. |
Product Property
| Species Reactivity | Rat |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS with 6% trehalose |
| Residues | 2-280aa |
| Sequence | AAAVQDSRVNPGGKLKRSPKKKKKMKKVAKAAVSKLEDELKDSSGGEGSCESEMDDSDDGAAEADSEDNVESCEEENEVAAESSAGTNSGWADAMAKILNKKTPKSKPTILTKNKELEKEKEKLKQERLEKRKQIDKKREWEMLCRVKPDVIKDKEAERNLQRIATRGVVQLFNAVQKHQRNVDEKVKEVGGSIRKRAKLMSTVSKKDFISVLRGMDGASENSSAGKSPKARQTEVKSEEGPGWKILRDDFMMGASMKDWDKESEGEEPADGQAGSASH |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Rrp15; RRP15-like protein; Ribosomal RNA-processing protein 15 |
| Gene ID | 360895 |
| UniProt ID | Q5M947 |
| Location | Cytoplasm |
| Introduction | RRP15 is a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of the pre-60S ribosomal particle and is required for the early maturation steps of the 60S subunit. Scientists have found that RRP15 may be a promising target for cancer treatment. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
