Recombinant Protein of Rat RPL4, aa 2-421(Cat#: RIJL-0225-JL226)
This product is a recombinant rat RPL4 protein with specific tag. It is availible for immunogen, SDS-PAGE, positive control and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant rat RPL4 protein with specific tag. It is availible for immunogen, SDS-PAGE, positive control and WB. |
Product Property
| Species Reactivity | Rat |
| Molecule Mass | 47.3 kDa |
| Purity | >80% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-421aa |
| Sequence | ACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHCVEEVPELPLVVEDKVESYKKTKEAVQLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMMNTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVKKLEAAAAALAAKSEKIVPEKGAGDKKPAVGKKGKKPVDAKKLKKPAGKKVVTKKPAEKKPTTEEKKSAA |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; Positive Control; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein UL4; 60S Ribosomal Protein L1; Ribosomal Protein L4; 60S Ribosomal Protein L4 |
| Gene ID | 64302 |
| UniProt ID | P50878 |
| Location | Cytoplasm |
| Introduction | RPL4 protein resides within the cytoplasm. Consistent with the pattern observed for genes encoding ribosomal proteins, numerous processed pseudogenes of the RPL4 gene are scattered throughout the genome. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
