Recombinant Protein of Rat RPL35, aa 2-123(Cat#: RIJL-0225-JL299)
This product is a recombinant rat RPL35 protein with specific tag. It is availible for immunogen, SDS-PAGE, ELISA and standard.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant rat RPL35 protein with specific tag. It is availible for immunogen, SDS-PAGE, ELISA and standard. |
Product Property
| Species Reactivity | Rat |
| Molecule Mass | 14.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-123aa |
| Sequence | AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLTKHEEKLKTKKQQRKERLYPLRKYAVKA |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; ELISA; Standard |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein UL29; Ribosomal Protein L35; 60S Ribosomal Protein L35 |
| Gene ID | 296709 |
| UniProt ID | P17078 |
| Location | Cytoplasm |
| Introduction | RPL35 protein is a fundamental constituent of the 60S ribosomal subunit. It is essential for the structural integrity and functional efficiency of the ribosome, thereby facilitating the accurate translation of mRNA into proteins. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
