Recombinant Protein of Rat RPL28, aa 2-137(Cat#: RIJL-0225-JL283)
This product is a recombinant rat RPL28 protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, immunogen and bioactivity testing.
Summary
Related Products & Services
Description
|
This product is a recombinant rat RPL28 protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, immunogen and bioactivity testing. |
Product Property
Species Reactivity |
Rat |
Molecule Mass |
15.8 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
2-137aa |
Sequence |
SAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEAWPDGKGVVVVMKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVVVKRKRTRPTKSS |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
SDS-PAGE; WB; ELISA; Immunogen; Bioactivity Testing |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Ribosomal protein L28; RPL28; rpl28; 60S ribosomal protein L28 |
Gene ID |
64638 |
UniProt ID |
P17702 |
Location |
Cytoplasm |
Introduction |
The RPL28 protein serves as a vital component of the large ribosomal subunit within the ribosome, a significant ribonucleoprotein complex tasked with synthesizing proteins within cells. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.