Recombinant Protein of Rat RPL28, aa 2-137(Cat#: RIJL-0225-JL283)
This product is a recombinant rat RPL28 protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, immunogen and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant rat RPL28 protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, immunogen and bioactivity testing. |
Product Property
| Species Reactivity | Rat |
| Molecule Mass | 15.8 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-137aa |
| Sequence | SAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEAWPDGKGVVVVMKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVVVKRKRTRPTKSS |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; ELISA; Immunogen; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal protein L28; RPL28; rpl28; 60S ribosomal protein L28 |
| Gene ID | 64638 |
| UniProt ID | P17702 |
| Location | Cytoplasm |
| Introduction | The RPL28 protein serves as a vital component of the large ribosomal subunit within the ribosome, a significant ribonucleoprotein complex tasked with synthesizing proteins within cells. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
