Recombinant Protein of Mouse RRP8, aa 1-457(Cat#: RIJL-1124-JL138)
This product is a recombinant mouse RRP8 protein with specific tag. It is availible for SDS-PAGE, WB, positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RRP8 protein with specific tag. It is availible for SDS-PAGE, WB, positive control and immunogen. |
Product Property
| Species Reactivity | Mouse |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS with 6% trehalose |
| Residues | 1-457aa |
| Sequence | MFEEPEWVEAAPAIVGLGAATAQVRPATAPPVKGRKRRHLLATLRALEAASLSQQTPSLPGSDSEEEEEVGRKKRHLQRPSLASVSKEVGKKRKGKCQKQAPSISDSEGKEIRRKCHRQAPPLGGVSAGEEKGKRKCQEYSSLHLTQPLDSVDQTVHNSRTSTATIDPSKPSPESMSPNSSHTLSRKQWRNRQKNKRRHKNKFRPLQTPEQAPPKASIEETEVPPVPKSDSQESRAGALRARMTQRLDGARFRYLNEQLYSGPSSAARRLFQEDPEAFLLYHRGFQRQVKKWPLHPVDRIAKDLRQKPASLVVADFGCGDCRLASSVRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKTGGLLKVAEVSSRFEDIRTFLGAVTKLGFKIIYKDLTNSHFFLFDFEKTGPPRVGPKAQLSGLKLQPCLYKRR |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Rrp8; Ribosomal RNA-processing protein 8; Cerebral protein 1 homolog |
| Gene ID | 101867 |
| UniProt ID | Q9DB85 |
| Location | Nucleus; Nucleolus |
| Introduction | RRP8 enables methylated histone binding activity. RRP8 is also involved in multiple processes, including the cellular response to glucose starvation. RRP8 is localized in multiple cellular compartments, including the nuclear lumen, cytosol, and rDNA heterochromatin. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
