Recombinant Protein of Mouse RPS3, aa 2-243(Cat#: RIJL-1124-JL197)
This product is a recombinant mouse RPS3 protein with C-terminal His tag. It is availible for positive control, immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPS3 protein with C-terminal His tag. It is availible for positive control, immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 34.0 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | E.coli |
| Formulation | PBS with 25% glycerol |
| Residues | 2-243aa |
| Sequence | AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA |
| Product Form | Lyophilized or liquid |
| Tags | C-terminal His Tag |
| Type | Recombinant Protein |
| Applications | Positive Control; Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal Protein S3; 40S Ribosomal Protein S3; US3; Small Ribosomal Subunit Protein US4 |
| Gene ID | 27050 |
| UniProt ID | P62908 |
| Location | Nucleus; Cytoplasm |
| Introduction | RPS3 is a critical but previously unknown subunit of NF-kB that plays a crucial role in regulating rapid cellular activation responses. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
