Recombinant Protein of Mouse RPL29, aa 2-160(Cat#: RIJL-0225-JL286)
This product is a recombinant mouse RPL29 protein with specific tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPL29 protein with specific tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 17.6 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-160aa |
| Sequence | AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGPKLKRLAFIAHPKLGKRIRSYMAKGQRLCQPKPKVQTKAGAKAPAKAQASAPAQAPKGAQAPKGAQAPVKAP |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal Protein YL43 Homologue; Ribosomal Protein L29; 60S Ribosomal Protein L29; Ribosomal Protein L29 Pseudogene 10 |
| Gene ID | 19944 |
| UniProt ID | P47915 |
| Location | Cytoplasm |
| Introduction | RPL29 is a fundamental component of the large ribosomal subunit, which is part of the ribosome-a substantial ribonucleoprotein complex that is accountable for synthesizing proteins within cells. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
