Recombinant Protein of Mouse RPL21, aa 2-160(Cat#: RIJL-0225-JL270)
This product is a recombinant mouse RPL21 protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, immunogen and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPL21 protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, immunogen and bioactivity testing. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 18.6 kDa |
| Purity | >83% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-160aa |
| Sequence | TNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRHAAPPREAHFVRTNGKEPELLEPIPYEFMA |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; ELISA; Immunogen; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein EL21; DKFZp686C06101; FLJ27458; Ribosomal Protein L21; 60S Ribosomal Protein L21 |
| Gene ID | 19933 |
| UniProt ID | O09167 |
| Location | Endoplasmic Reticulum; Cytosol; Cytoplasm |
| Introduction | RPL21 protein is a vital component of the 60S ribosomal subunit. This protein falls within the L21E family of ribosomal proteins and resides in the cytoplasm. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
