Recombinant Protein of Mouse RPL18A, aa 1-176(Cat#: RIJL-0225-JL266)
This product is a recombinant mouse RPL18A protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, bioactivity testing and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPL18A protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, bioactivity testing and immunogen. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 20.7 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-176aa |
| Sequence | MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAAGKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; ELISA; Bioactivity Testing; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Rpl18a; 60S ribosomal protein L18a |
| Gene ID | 76808 |
| UniProt ID | P62717 |
| Location | Cytoplasm |
| Introduction | RPL18A serves as a component of the 60S subunit. This protein resides within the cytoplasm. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
