Recombinant Protein of Mouse RPL18, aa 2-188(Cat#: RIJL-0225-JL264)
This product is a recombinant mouse RPL18 protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, bioactivity testing and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPL18 protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, bioactivity testing and immunogen. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 21.6 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-188aa |
| Sequence | GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; ELISA; Bioactivity Testing; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein EL18; DBA18; Ribosomal Protein L18; 60S Ribosomal Protein L18 |
| Gene ID | 19899 |
| UniProt ID | P35980 |
| Location | Cytoplasm; Cytosol |
| Introduction | RPL18 is a constituent of the large ribosomal subunit, which is part of the ribosome-a large ribonucleoprotein complex that plays a crucial role in synthesizing proteins within cells. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
