Recombinant Protein of Mouse RPL13A, aa 2-203(Cat#: RIJL-0225-JL256)
This product is a recombinant mouse RPL13A protein with N-terminal His Tag. It is availible for ELISA, immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPL13A protein with N-terminal His Tag. It is availible for ELISA, immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 23.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-203aa |
| Sequence | AEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTNGLLV |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | ELISA; Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein UL13; 60S Ribosomal Protein L13a; Highly Basic Protein 23 Kda; Ribosomal Protein L13a; Tissue Specific Transplantation Antigen 1 |
| Gene ID | 22121 |
| UniProt ID | P19253 |
| Location | Cytoplasm |
| Introduction | RPL13A is associated with ribosomes yet is dispensable for traditional ribosome function, exhibiting additional roles beyond the ribosome. Furthermore, RPL13A is implicated in the methylation of rRNA. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
