Recombinant Protein of Mouse MRPS21, aa 1-87(Cat#: RIJL-0225-JL504)
This product is a recombinant mouse MRPS21 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse MRPS21 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 10.6 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-87aa |
| Sequence | MAKHLKFIARTVMVQEGNVEGAYRTLNRILTTDGLTEVISRRRYYEKPCRRRQRESYETCRRIYNMEMARKINFLMRKNRADPWLGC |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial small ribosomal subunit protein bS21m; S21mt; MRP-S21 |
| Gene ID | 66292 |
| UniProt ID | P58059 |
| Location | Mitochondrion |
| Introduction | MRPS21 protein is integral to maintaining proper mitochondrial function and, consequently, efficient energy production through oxidative phosphorylation. Mutations or abnormalities in the MRPS21 gene have been implicated in a range of mitochondrial disorders. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
