Recombinant Protein of Mouse MRPS21, aa 1-87(Cat#: RIJL-0225-JL504)
This product is a recombinant mouse MRPS21 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse MRPS21 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
Species Reactivity |
Mouse |
Molecule Mass |
10.6 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
1-87aa |
Sequence |
MAKHLKFIARTVMVQEGNVEGAYRTLNRILTTDGLTEVISRRRYYEKPCRRRQRESYETCRRIYNMEMARKINFLMRKNRADPWLGC |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Immunogen; SDS-PAGE; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Mitochondrial small ribosomal subunit protein bS21m; S21mt; MRP-S21 |
Gene ID |
66292 |
UniProt ID |
P58059 |
Location |
Mitochondrion |
Introduction |
MRPS21 protein is integral to maintaining proper mitochondrial function and, consequently, efficient energy production through oxidative phosphorylation. Mutations or abnormalities in the MRPS21 gene have been implicated in a range of mitochondrial disorders. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.